제품 > 항체 > 다중클론항체(pAb)

SHARPIN Rabbit pAb (A11714)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using SHARPIN Rabbit pAb (A11714) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SHARPIN Rabbit pAb
Catalog No.	A11714
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables polyubiquitin modification-dependent protein binding activity. Involved in protein linear polyubiquitination and regulation of signal transduction. Located in cytosol. Part of LUBAC complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SHARPIN (NP_112236.3).
Sequence	MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLT
Gene ID
Swiss Prot
Synonyms	SIPL1; SHARPIN
Calculated MW	40kDa
Observed MW	40kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, LO2, HeLa, A-549, Rat brain
Cellular location	Cell junction, Cytoplasm, cytosol, synapse