Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Monkey
Product name | SLC12A3 Rabbit pAb |
---|---|
Catalog No. | A18382 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SLC12A3 (NP_000330.2). |
---|---|
Sequence | MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNTIDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEGEAGTSSEKNPEEPVRFGWVK |
Gene ID | |
Swiss Prot | |
Synonyms | NCC; TSC; NCCT; SLC12A3 |
Calculated MW | 113kDa |
Observed MW | 100-170kDa |
Reactivity | Human, Mouse, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, COS-7, Mouse kidney |
Cellular location | apical plasma membrane, cytosol, extracellular exosome, plasma membrane |
* For research use only. Not for therapeutic or diagnostic purposes.