Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SLC14A2 Rabbit pAb |
---|---|
Catalog No. | A13208 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-580 of human SLC14A2 (NP_009094.3). |
---|---|
Sequence | FRLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQF |
Gene ID | |
Swiss Prot | |
Synonyms | UT2; UTA; UTR; HUT2; UT-A2; hUT-A6; SLC14A2 |
Calculated MW | 101kDa |
Observed MW | 101kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, K-562, LO2, Mouse testis, Mouse brain |
Cellular location | Apical cell membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.