제품 > 항체 > 다중클론항체(pAb)

SLC17A6 Rabbit pAb (A13648)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using SLC17A6 Rabbit pAb (A13648) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SLC17A6 Rabbit pAb
Catalog No.	A13648
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 483-582 of human SLC17A6 (NP_065079.1).
Sequence	AALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Gene ID
Swiss Prot
Synonyms	DNPI; VGLUT2; SLC17A6
Calculated MW	64kDa
Observed MW	64kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Rat brain
Cellular location	Cell junction, Cytoplasmic vesicle, Membrane, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome.
Customer validation	WB(Mus musculus)