제품 > 항체 > 다중클론항체(pAb)

SLC39A2 Rabbit pAb (A18452)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of lysates from Rat brain, using SLC39A2 Rabbit pAb (A18452) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	SLC39A2 Rabbit pAb
Catalog No.	A18452
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A2 (NP_055394.2).
Sequence	MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHM
Gene ID
Swiss Prot
Synonyms	6A1; ZIP2; ETI-1; ZIP-2; SLC39A2
Calculated MW	33kDa
Observed MW	33kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat brain
Cellular location	cytoplasmic ribonucleoprotein granule, cytoplasmic vesicle, plasma membrane