제품 > 항체 > 단일클론항체(mAb)

SLC3A2/CD98hc Rabbit mAb (A3658)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using SLC3A2/CD98hc Rabbit mAb (A3658) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	SLC3A2/CD98hc Rabbit mAb
Catalog No.	A3658
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0816

Background

This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC3A2/CD98hc (P08195).
Sequence	IENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL
Gene ID
Swiss Prot
Synonyms	4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC; SLC3A2/CD98hc
Calculated MW	58kDa
Observed MW	90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Raji
Cellular location	anchoring junction, apical plasma membrane, basal plasma membrane, basolateral plasma membrane, extracellular exosome, nucleoplasm, plasma membrane.
Customer validation	WB(Homo sapiens, Mus musculus)