Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SLC3A2/CD98hc Rabbit mAb |
---|---|
Catalog No. | A3658 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0816 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC3A2/CD98hc (P08195). |
---|---|
Sequence | IENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLL |
Gene ID | |
Swiss Prot | |
Synonyms | 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC; SLC3A2/CD98hc |
Calculated MW | 58kDa |
Observed MW | 90kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, Raji |
Cellular location | anchoring junction, apical plasma membrane, basal plasma membrane, basolateral plasma membrane, extracellular exosome, nucleoplasm, plasma membrane. |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3658? Please let us know so that we can cite the reference in this datasheet.