제품 > 항체 > 단일클론항체(mAb)

SNRPA1 Rabbit mAb (A0647)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using SNRPA1 Rabbit mAb (A0647) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - SNRPA1 Rabbit mAb (A0647)

Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human liver tissue using SNRPA1 Rabbit mAb (A0647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human esophagus tissue using SNRPA1 Rabbit mAb (A0647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SNRPA1 in paraffin-embedded mouse intestin tissue using SNRPA1 Rabbit mAb (A0647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SNRPA1 in paraffin-embedded human thyroid tissue using SNRPA1 Rabbit mAb (A0647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SNRPA1 in paraffin-embedded rat intestine tissue using SNRPA1 Rabbit mAb (A0647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	SNRPA1 Rabbit mAb
Catalog No.	A0647
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2532

Background

Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and spermatogenesis. Located in nuclear speck. Part of U2-type catalytic step 2 spliceosome and U2-type precatalytic spliceosome. Implicated in connective tissue disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661).
Sequence	QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Gene ID
Swiss Prot
Synonyms	Lea1; U2A'; SNRPA1
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, RD, SH-SY5Y, Mouse liver, Mouse brain, Mouse pancreas
Cellular location	Nucleus
Customer validation	WB(Sus scrofa)