제품 > 항체 > 단일클론항체(mAb)

SOX10 Rabbit mAb (A8655)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SOX10 Rabbit mAb (A8655) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - SOX10 Rabbit mAb (A8655)

Immunofluorescence analysis of C6 cells using SOX10 Rabbit mAb (A8655) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	SOX10 Rabbit mAb
Catalog No.	A8655
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1767

Background

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693).
Sequence	VDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH
Gene ID
Swiss Prot
Synonyms	DOM; WS4; PCWH; WS2E; WS4C; SOX-10; SOX10
Calculated MW	50kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HT-29, SH-SY5Y, Mouse large intestine, Mouse brain, Mouse heart, Rat brain, Rat heart
Cellular location	Cytoplasm, Nucleus, Mitochondrion outer membrane.
Customer validation	WB(Homo sapiens)