제품 > 항체 > 단일클론항체(mAb)

SOX10 Rabbit mAb (A8658)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SOX10 Rabbit mAb (A8658) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - SOX10 Rabbit mAb (A8658)

Immunohistochemistry analysis of SOX10 in paraffin-embedded mouse brain tissue using SOX10 Rabbit mAb (A8658) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SOX10 in paraffin-embedded human brain tissue using SOX10 Rabbit mAb (A8658) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SOX10 in paraffin-embedded human breast tissue using SOX10 Rabbit mAb (A8658) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SOX10 in paraffin-embedded rat brain tissue using SOX10 Rabbit mAb (A8658) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - SOX10 Rabbit mAb (A8658)

Confocal imaging of C6 cells using SOX10 Rabbit mAb (A8658, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - SOX10 Rabbit mAb (A8658)

Immunoprecipitation analysis of 300 μg extracts of C6 cells using 3 μg SOX10 antibody (A8658). Western blot was performed from the immunoprecipitate using SOX10 antibody (A8658) at a dilution of 1:1000.

Overview

Product name	SOX10 Rabbit mAb
Catalog No.	A8658
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1768

Background

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SOX10 (P56693).
Sequence	VDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH
Gene ID
Swiss Prot
Synonyms	DOM; WS4; PCWH; WS2E; WS4C; SOX-10; SOX10
Calculated MW	31kDa/50kDa
Observed MW	60-70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	C6, Mouse brain, Rat brain
Cellular location	Cytoplasm, Nucleus