제품 > 항체 > 다중클론항체(pAb)

SPHK1 Rabbit pAb (A25694)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of SPHK1 in paraffin-embedded Mouse kidney tissue using SPHK1 Rabbit pAb (A25694) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SPHK1 in paraffin-embedded Rat testis tissue using SPHK1 Rabbit pAb (A25694) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SPHK1 in paraffin-embedded Human liver cancer tissue using SPHK1 Rabbit pAb (A25694) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Overview

Product name	SPHK1 Rabbit pAb
Catalog No.	A25694
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellularly, it is a ligand for cell surface G protein-coupled receptors. This protein, and its product S1P, play a key role in TNF-alpha signaling and the NF-kappa-B activation pathway important in inflammatory, antiapoptotic, and immune processes. Phosphorylation of this protein alters its catalytic activity and promotes its translocation to the plasma membrane. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 201-300 of human SPHK1 (NP_001136074.1).
Sequence	AALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
Gene ID
Swiss Prot
Synonyms	SPHK
Calculated MW	43kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Cell membrane, Cytoplasm, Nucleus, clathrin-coated pit, cytoplasm, cytosol, nucleus, plasma membrane, presynapse