Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SRSF2 Rabbit pAb |
---|---|
Catalog No. | A3635 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF2 (NP_001182356.1). |
---|---|
Sequence | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHH |
Gene ID | |
Swiss Prot | |
Synonyms | SC35; PR264; SC-35; SFRS2; SFRS2A; SRp30b; SRSF2 |
Calculated MW | 25kDa |
Observed MW | 28kDa/32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse lung, Raji, THP-1 |
Cellular location | Nucleus, Nucleus speckle, nucleoplasm. |
Customer validation | WB(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3635? Please let us know so that we can cite the reference in this datasheet.