Review (1)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STAT5 Rabbit mAb |
---|---|
Catalog No. | A5029 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1215 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 600-786 of human STAT5 (P42229). |
---|---|
Sequence | KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLF |
Gene ID | |
Swiss Prot | |
Synonyms | MGF; STAT5 |
Calculated MW | 90kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, PC-3, Mouse heart, Rat lung |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (293T、MOLT-4、T47D、HeLa、A549、HepG2、MCF7、RPMI-8226) WB(Homo sapiens, Mus musculus, Rattus norvegicus) FC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5029? Please let us know so that we can cite the reference in this datasheet.