제품 > 항체 > 다중클론항체(pAb)

STEAP1 Rabbit pAb (A17684)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using STEAP1 Rabbit pAb (A17684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	STEAP1 Rabbit pAb
Catalog No.	A17684
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STEAP1 (NP_036581.1).
Sequence	MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI
Gene ID
Swiss Prot
Synonyms	STEAP; PRSS24; STEAP1
Calculated MW	40kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	PC-3, HepG2, DU145, Mouse testis, Rat brain
Cellular location	cell-cell junction, endosome, plasma membrane