제품 > 항체 > 다중클론항체(pAb)

STK39 Rabbit pAb (A7974)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using STK39 antibody (A7974) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	STK39 Rabbit pAb
Catalog No.	A7974
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-600 of human STK39 (Q9UEW8).
Sequence	VAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQLSVS
Gene ID
Swiss Prot
Synonyms	DCHT; PASK; SPAK
Calculated MW	59kDa
Observed MW	59kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, PC-12, Mouse testis, Mouse brain
Cellular location	Cytoplasm, Nucleus