제품 > 항체 > 다중클론항체(pAb)

STK3/MST2 Rabbit pAb (A6992)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using STK3/MST2 antibody (A6992) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - STK3/MST2 Rabbit pAb (A6992)

Immunofluorescence analysis of NIH-3T3 cells using STK3/MST2 Polyclonal Antibody (A6992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	STK3/MST2 Rabbit pAb
Catalog No.	A6992
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal portion is transported to the nucleus where it homodimerizes to form the active kinase which promotes the condensation of chromatin during apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 323-450 of human STK3/MST2 (NP_006272.2).
Sequence	SHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQM
Gene ID
Swiss Prot
Synonyms	KRS1; MST2
Calculated MW	56kDa
Observed MW	65kDa, 37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HeLa, Jurkat, MCF7, NIH/3T3, Mouse liver, Mouse brain, Mouse kidney
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Xenopus laevis)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

STK3/MST2 Rabbit pAb images

Western blot - STK3/MST2 Rabbit pAb (A6992)

Immunofluorescence - STK3/MST2 Rabbit pAb (A6992)

Immunofluorescence analysis of NIH-3T3 cells using STK3/MST2 Polyclonal Antibody (A6992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.