제품 > 항체 > 다중클론항체(pAb)

Siglec1 Rabbit pAb (A22677)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of lysates from Rat spleen using Siglec1 Rabbit pAb (A22677) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Siglec1 Rabbit pAb
Catalog No.	A22677
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable virion binding activity. Acts upstream of or within positive regulation of T cell apoptotic process and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be located in extracellular region and membrane. Predicted to be integral component of membrane. Predicted to be active in early endosome; late endosome; and plasma membrane. Is expressed in immune system; reproductive system; and skin. Orthologous to human SIGLEC1 (sialic acid binding Ig like lectin 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-138 of mouse Siglec1(NP_035556.3).
Sequence	TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Gene ID
Swiss Prot
Synonyms	Sn; Cd169; Siglec-1; Siglec1
Calculated MW	183kDa
Observed MW	200kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat spleen
Cellular location	early endosome, extracellular region, late endosome, plasma membrane.