제품 > 항체 > 단일클론항체(mAb)

Snail Rabbit mAb (A24806)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T transfected with Snail, using Snail Rabbit mAb (A24806) at 1:9000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - Snail Rabbit mAb (A24806)

Immunofluorescence analysis of 293F cells transfected with Snail, using Snail Rabbit mAb (A24806) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Snail Rabbit mAb (A24806)

Immunoprecipitation analysis of 300ug extracts from 293F cells transfected with Snail using 3ug Snail Rabbit mAb (A24806 1:100). Western blot was performed from the immunoprecipitate using Snail Rabbit mAb (A24806) at a dilition of 1:9000.

Overview

Product name	Snail Rabbit mAb
Catalog No.	A24806
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62698

Background

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-157 of human Snail (NP_005976.2).
Sequence	QESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCK
Gene ID
Swiss Prot
Synonyms	SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail
Calculated MW	29kDa
Observed MW	35kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:9000 - 1:54000 IF/ICC 1:200 - 1:400 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T transfected with Snail (Human)
Cellular location	Cytoplasm, Nucleus.