제품 > 항체 > 다중클론항체(pAb)

Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101)

Immunofluorescence analysis of C6 cells using Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Somatostatin Receptor 2 (SSTR2) Rabbit pAb (A15101) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Somatostatin Receptor 2 (SSTR2) Rabbit pAb
Catalog No.	A15101
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 270-369 of human Somatostatin Receptor 2 (SSTR2) (NP_001041.1).
Sequence	LPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Gene ID
Swiss Prot
Synonyms	SST2; Somatostatin Receptor 2 (SSTR2)
Calculated MW	41kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	mouse kidney, mouse liver
Cellular location	Cell membrane, Cytoplasm, Multi-pass membrane protein