제품 > 항체 > 단일클론항체(mAb)

TACC3 Rabbit mAb (A19617)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from 293T cells, using TACC3 Rabbit mAb (A19617) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - TACC3 Rabbit mAb (A19617)

Immunohistochemistry analysis of TACC3 in paraffin-embedded human colon tissue using TACC3 Rabbit mAb (A19617) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TACC3 in paraffin-embedded human tonsil tissue using TACC3 Rabbit mAb (A19617) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - TACC3 Rabbit mAb (A19617)

Immunofluorescence analysis of NIH/3T3 cells using TACC3 Rabbit mAb (A19617) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using TACC3 Rabbit mAb (A19617) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TACC3 Rabbit mAb
Catalog No.	A19617
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2195

Background

TACC3, also known as ERIC 1, belongs to the TACC family. TACC family members TACC1, TACC2, and TACC3 map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 8, 10, and 4. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. It plays a role in the microtubule-dependent coupling of the nucleus and the centrosome and involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TACC3 (NP_006333.1).
Sequence	MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Gene ID
Swiss Prot
Synonyms	ERIC1; Tacc4; ERIC-1; maskin; TACC3
Calculated MW	90kDa
Observed MW	140kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T
Cellular location	Cytoplasm, Cytosol, mitotic spindle, spindle pole