TACC3 Rabbit pAb (A18641)

Publication (1) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - TACC3 Rabbit pAb (A18641)

Immunofluorescence analysis of U2OS cells using TACC3 Rabbit pAb (A18641) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	TACC3 Rabbit pAb
Catalog No.	A18641
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle. This protein may also play a role in growth a differentiation of certain cancer cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-140 of human TACC3 (NP_006333.1).
Sequence	CDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQKPVEADTDLLGDASPAFGSGS
Gene ID
Swiss Prot
Synonyms	ERIC1; Tacc4; ERIC-1; maskin; TACC3
Calculated MW	90kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens)