제품 > 항체 > 다중클론항체(pAb)

TAF3 Rabbit pAb (A17358)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TAF3 Rabbit pAb (A17358) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	TAF3 Rabbit pAb
Catalog No.	A17358
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The highly conserved RNA polymerase II transcription factor TFIID (see TAF1; MIM 313650) comprises the TATA box-binding protein (TBP; MIM 600075) and a set of TBP-associated factors (TAFs), including TAF3. TAFs contribute to promoter recognition and selectivity and act as antiapoptotic factors (Gangloff et al., 2001 [PubMed 11438666]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF3 (NP_114129.1).
Sequence	HRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTS
Gene ID
Swiss Prot
Synonyms	TAF140; TAFII140; TAFII-140; TAF3
Calculated MW	104kDa
Observed MW	80kDa/140kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562, HeLa, mouse spleen, mouse brain, rat brain
Cellular location	male germ cell nucleus, nuclear membrane, nucleoplasm, nucleus