제품 > 항체 > 다중클론항체(pAb)

TAGLN Rabbit pAb (A25499)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from Hep G2 cells using TAGLN Rabbit pAb(A25499) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:10s.

ABclonal:Immunohistochemistry - TAGLN Rabbit pAb (A25499)

Immunohistochemistry analysis of TAGLN in paraffin-embedded Human breast tissue using TAGLN Rabbit pAb (A25499) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TAGLN in paraffin-embedded Human breast cancer tissue using TAGLN Rabbit pAb (A25499) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TAGLN in paraffin-embedded Rat colon tissue using TAGLN Rabbit pAb (A25499) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TAGLN in paraffin-embedded Rat heart tissue using TAGLN Rabbit pAb (A25499) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Overview

Product name	TAGLN Rabbit pAb
Catalog No.	A25499
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-201 of human TAGLN (NP_003177.2).
Sequence	AAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Gene ID
Swiss Prot
Synonyms	SM22; SMCC; TAGLN1; WS3-10; SM22-alpha
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:2000 - 1:10000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Hep G2
Cellular location	Cytoplasm, cytoskeleton