Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from HeLa cells using TAZ Rabbit PolymAb® (A26425PM)at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using TAZ Rabbit PolymAb® (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TAZ Rabbit PolymAb® (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TAZ Rabbit PolymAb® (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAZ Rabbit PolymAb® (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
| Product name | TAZ Rabbit PolymAb® |
|---|---|
| Catalog No. | A26425PM |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human TAZ (NP_056287.1) |
|---|---|
| Sequence | MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TAZ |
| Calculated MW | 44kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa |
| Cellular location | Cytoplasm, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
