제품 > 항체 > 다중클론항체(pAb)

TAZ Rabbit pAb (A15806)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using TAZ antibody (A15806) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TAZ Rabbit pAb (A15806)

Immunofluorescence analysis of U2OS cells using TAZ antibody (A15806) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	TAZ Rabbit pAb
Catalog No.	A15806
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables transcription coactivator activity. Involved in several processes, including hippo signaling; positive regulation of cell differentiation; and regulation of signal transduction. Located in cytosol and nuclear body.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TAZ (NP_056287.1).
Sequence	LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Gene ID
Swiss Prot
Synonyms	TAZ
Calculated MW	44kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	NCI-H460, Mouse lung
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus)