Review (1)Publications (19) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TBK1/NAK Rabbit mAb |
---|---|
Catalog No. | A3458 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0778 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2). |
---|---|
Sequence | MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE |
Gene ID | |
Swiss Prot | |
Synonyms | NAK; T2K; IIAE8; FTDALS4; TBK1/NAK |
Calculated MW | 84kDa |
Observed MW | 84kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | 293T, Hep G2, Mouse lung, Mouse testis, Rat testis |
Cellular location | Cytoplasm. |
Customer validation | (RPMI-8226、A549、PC-3、HepG2、HL-60、Hela、U2-OS、Jurkat) WB(Homo sapiens, Gallus gallus, Mus musculus, Rattus norvegicus, Danio rerio) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3458? Please let us know so that we can cite the reference in this datasheet.