Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using TBK1/NAK Rabbit mAb (A3458) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of various lysates using TBK1/NAK Rabbit mAb (A3458) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Confocal imaging of MCF7 cells using TBK1/NAK Rabbit mAb (A3458, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using TBK1/NAK Rabbit mAb (A3458, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts from 293T cells using 3 μg TBK1/NAK Rabbit mAb (A3458). Western blot was performed from the immunoprecipitate using TBK1/NAK Rabbit mAb (A3458) at a dilution of 1:1000.
| Product name | TBK1/NAK Rabbit mAb |
|---|---|
| Catalog No. | A3458 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0778 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1/NAK (Q9UHD2). |
|---|---|
| Sequence | MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NAK; T2K; IIAE8; FTDALS4; TBK1/NAK |
| Calculated MW | 84kDa |
| Observed MW | 84kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | 293T, Hep G2, Mouse lung, Mouse testis, Rat testis |
| Cellular location | Cytoplasm. |
| Customer validation | (RPMI-8226、A549、PC-3、HepG2、HL-60、Hela、U2-OS、Jurkat) WB(Homo sapiens, Gallus gallus, Mus musculus, Rattus norvegicus, Danio rerio) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3458? Please let us know so that we can cite the reference in this datasheet.
