Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TBK1/NAK Rabbit pAb |
---|---|
Catalog No. | A2573 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TBK1/NAK (NP_037386.1). |
---|---|
Sequence | DIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH |
Gene ID | |
Swiss Prot | |
Synonyms | NAK; T2K; IIAE8; FTDALS4; TBK1/NAK |
Calculated MW | 84kDa |
Observed MW | 84kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HepG2, HeLa, Mouse lung, Rat thymus |
Cellular location | Cytoplasm. |
Customer validation | WB(Anatinae, Homo sapiens, Mus musculus, Chlorocebus aethiops , Sus scrofa) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2573? Please let us know so that we can cite the reference in this datasheet.