제품 > 항체 > 다중클론항체(pAb)

TCEB1 Rabbit pAb (A12515)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TCEB1 Rabbit pAb (A12515) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - TCEB1 Rabbit pAb (A12515)

Immunohistochemistry analysis of paraffin-embedded Mouse liver using TCEB1 Rabbit pAb (A12515) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human prostate using TCEB1 Rabbit pAb (A12515) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	TCEB1 Rabbit pAb
Catalog No.	A12515
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1).
Sequence	MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Gene ID
Swiss Prot
Synonyms	SIII; TCEB1
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, PC-3, MCF7, HepG2, Mouse liver, Mouse lung, Mouse testis, Mouse brain, Rat brain
Cellular location	Nucleus.
Customer validation	WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학유비퀴틴유비퀴틴-프로테아좀 신호전달 경로

TCEB1 Rabbit pAb images

Western blot - TCEB1 Rabbit pAb (A12515)

Immunohistochemistry - TCEB1 Rabbit pAb (A12515)

Immunohistochemistry analysis of paraffin-embedded Mouse liver using TCEB1 Rabbit pAb (A12515) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry - TCEB1 Rabbit pAb (A12515)

* For research use only. Not for therapeutic or diagnostic purposes.