Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TET2 Rabbit pAb |
---|---|
Catalog No. | A5682 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 (NP_001120680.1). |
---|---|
Sequence | VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI |
Gene ID | |
Swiss Prot | |
Synonyms | MDS; IMD75; KIAA1546; TET2 |
Calculated MW | 224kDa |
Observed MW | 280kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse heart, Mouse brain, Rat brain |
Cellular location | nucleus. |
Customer validation | IF(Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Homo sapiens) WB(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus) qPCR(Homo sapiens) Other(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5682? Please let us know so that we can cite the reference in this datasheet.