제품 > 항체 > 단일클론항체(mAb)

THOC4/ALYREF Rabbit mAb (A4298)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using THOC4/THOC4/ALYREFREF Rabbit mAb (A4298) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - THOC4/ALYREF Rabbit mAb (A4298)

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded mouse heart tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded rat testis tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded human spleen tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded mouse colon tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded mouse brain tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of THOC4/ALYREF in paraffin-embedded human esophagus tissue using THOC4/ALYREF Rabbit mAb (A4298) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	THOC4/ALYREF Rabbit mAb
Catalog No.	A4298
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0959

Background

The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 158-257 of human THOC4/ALYREFREF (Q86V81).
Sequence	DALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS
Gene ID
Swiss Prot
Synonyms	ALY; BEF; REF; THOC4; ALY/REF; THOC4/ALYREF
Calculated MW	27kDa
Observed MW	32kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, A-549, Mouse brain
Cellular location	Nucleus. Nucleus speckle. Cytoplasm. Colocalizes with the core EJC, THOC4, NXF1 and DDX39B in the nucleus and nuclear speckles. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA.
Customer validation	WB(Canis familiaris)