Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using THOC4/ALYREF Rabbit pAb (A6010) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Rat lung using THOC4/THOC4/ALYREF Rabbit pAb (A6010) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver using THOC4/THOC4/ALYREF Rabbit pAb (A6010) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of C6 cells using THOC4/ALYREF Rabbit pAb (A6010) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using THOC4/ALYREF Rabbit pAb (A6010) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using THOC4/ALYREF Rabbit pAb (A6010) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | THOC4/ALYREF Rabbit pAb |
|---|---|
| Catalog No. | A6010 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human THOC4/THOC4/ALYREF (NP_005773.3). |
|---|---|
| Sequence | MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ALY; BEF; REF; THOC4; ALY/REF; THOC4/ALYREF |
| Calculated MW | 27kDa |
| Observed MW | 30kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, A-549, B cells, SKOV3, HL-60, Mouse testis, Mouse spleen, Mouse thymus, Rat brain |
| Cellular location | Cytoplasm, Nucleus, Nucleus speckle. |
| Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6010? Please let us know so that we can cite the reference in this datasheet.
