Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | THSD4 Rabbit pAb |
---|---|
Catalog No. | A17773 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human THSD4 (NP_079093.2). |
---|---|
Sequence | AEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPHRRPGEPFNGQMVTEGRSQEEGEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQ |
Gene ID | |
Swiss Prot | |
Synonyms | AAT12; ADAMTSL6; FVSY9334; PRO34005; ADAMTSL-6; THSD4 |
Calculated MW | 112kDa |
Observed MW | 112kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y |
Cellular location | extracellular exosome |
Customer validation | WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17773? Please let us know so that we can cite the reference in this datasheet.