Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | TNKS Rabbit pAb |
---|---|
Catalog No. | A17027 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human TNKS (NP_003738.2). |
---|---|
Sequence | EQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI |
Gene ID | |
Swiss Prot | |
Synonyms | TIN1; ARTD5; PARPL; TINF1; TNKS1; pART5; PARP5A; PARP-5a; TNKS |
Calculated MW | 142kDa |
Observed MW | 179kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji, U-251MG |
Cellular location | cytoplasm, cytosol, Golgi apparatus, mitotic spindle pole, nuclear body, nuclear membrane, nuclear pore, nucleoplasm, nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.