제품 > 항체 > 다중클론항체(pAb)

TRAF3IP2 Rabbit pAb (A6776)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TRAF3IP2 Rabbit pAb (A6776) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from Rat lung, using TRAF3IP2 Rabbit pAb (A6776) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - TRAF3IP2 Rabbit pAb (A6776)

Immunofluorescence analysis of Hep G2 cells using TRAF3IP2 Rabbit pAb(A6776) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TRAF3IP2 Rabbit pAb
Catalog No.	A6776
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TRAF3IP2 (NP_671733.2).
Sequence	MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
Gene ID
Swiss Prot
Synonyms	ACT1; CIKS; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; PSORS13; TRAF3IP2
Calculated MW	65kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat lung, Mouse lung, Mouse heart
Cellular location	cytoplasmic vesicle, nucleus.
Customer validation	IHC(Homo sapiens) WB(Mus musculus)