제품 > 항체 > 단일클론항체(mAb)

TRAP1 Rabbit mAb (A23462)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HCT116 cells, using TRAP1 Rabbit mAb (A23462) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - TRAP1 Rabbit mAb (A23462)

Immunoprecipitation analysis of 300 μg extracts of HCT116 cells using 3 μg TRAP1 antibody (A23462). Western blot was performed from the immunoprecipitate using TRAP1 antibody (A23462) at a dilution of 1:500.

Overview

Product name	TRAP1 Rabbit mAb
Catalog No.	A23462
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2650

Background

This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stress responses. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2).
Sequence	EELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAA
Gene ID
Swiss Prot
Synonyms	HSP75; HSP 75; HSP90L; TRAP-1; TRAP1
Calculated MW	80kDa
Observed MW	75kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HCT116
Cellular location	Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix