Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | TRAP1 Rabbit mAb |
---|---|
Catalog No. | A3971 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0876 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TRAP1 (Q12931). |
---|---|
Sequence | MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDI |
Gene ID | |
Swiss Prot | |
Synonyms | HSP75; HSP 75; HSP90L; TRAP-1 |
Calculated MW | 80kDa |
Observed MW | 75kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, A-549, U-251MG, Mouse kidney |
Cellular location | Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3971? Please let us know so that we can cite the reference in this datasheet.