제품 > 항체 > 단일클론항체(mAb)

TRAP1 Rabbit mAb (A3971)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using TRAP1 Rabbit mAb (A3971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	TRAP1 Rabbit mAb
Catalog No.	A3971
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0876

Background

This gene encodes a mitochondrial chaperone protein that is a member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stress responses. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TRAP1 (Q12931).
Sequence	MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDI
Gene ID
Swiss Prot
Synonyms	HSP75; HSP 75; HSP90L; TRAP-1
Calculated MW	80kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, A-549, U-251MG, Mouse kidney
Cellular location	Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix
Customer validation	WB(Mus musculus)