Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | TRPV1 Rabbit mAb |
---|---|
Catalog No. | A23386 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57842 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 725-839 of human TRPV1 (NP_542435.2). |
---|---|
Sequence | KLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSGSLKPEDAEVFKSPAASGEK |
Gene ID | |
Swiss Prot | |
Synonyms | VR1 |
Calculated MW | 95kDa |
Observed MW | 100kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Cell projection, dendritic spine membrane, postsynaptic cell membrane, synaps |
Customer validation | IF(Canis familiaris) WB(Canis familiaris) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23386? Please let us know so that we can cite the reference in this datasheet.