제품 > 항체 > 다중클론항체(pAb)

TUG/ASPSCR1 Rabbit pAb (A7481)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TUG/ASPSCR1 Rabbit pAb (A7481) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - TUG/ASPSCR1 Rabbit pAb (A7481)

Immunofluorescence analysis of HeLa cells using TUG/ASPSCR1 Rabbit pAb (A7481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using TUG/ASPSCR1 Rabbit pAb (A7481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using TUG/ASPSCR1 Rabbit pAb (A7481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - TUG/ASPSCR1 Rabbit pAb (A7481)

Immunoprecipitation analysis of 200 μg extracts of A-549 cells, using 3 μg TUG/ASPSCR1 antibody (A7481). Western blot was performed from the immunoprecipitate using TUG/ASPSCR1 antibody (A7481) at a dilution of 1:1000.

Overview

Product name	TUG/ASPSCR1 Rabbit pAb
Catalog No.	A7481
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene contains a UBX domain and interacts with glucose transporter type 4 (GLUT4). This protein is a tether, which sequesters the GLUT4 in intracellular vesicles in muscle and fat cells in the absence of insulin, and redistributes the GLUT4 to the plasma membrane within minutes of insulin stimulation. Translocation t(X;17)(p11;q25) of this gene with transcription factor TFE3 gene results in a ASPSCR1-TFE3 fusion protein in alveolar soft part sarcoma and in renal cell carcinomas. Multiple alternatively spliced transcript variants have been found.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 284-553 of human TUG/ASPSCR1 (NP_076988.1).
Sequence	KSKSGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVVCHPDLEERLQAWPAELPDEFFELTVDDVRRRLAQLKSERKRLEEAPLVTKAFREAQIKEKLERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGNPELSFYLFITPPKTVLDDHTQTLFQANLFPAALVHLGAEEPAGVYLEPGLLEHAISPSAADVLVARYMSRAAGSPSPLPAPDPAPKSEPAAEEGALVPPEPIPGTAQPVKRSLGKVPKWLKLPASKR
Gene ID
Swiss Prot
Synonyms	TUG; ASPL; ASPS; RCC17; UBXD9; UBXN9; ASPCR1; TUG/ASPSCR1
Calculated MW	60kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, SW480, A-549, BT-474, Mouse liver, Mouse testis
Cellular location	Cytoplasm, Endomembrane system, Endoplasmic reticulum-Golgi intermediate compartment membrane, Nucleus, Peripheral membrane protein