제품 > 항체 > 단일클론항체(mAb)

Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using Thioredoxin 1 (Trx1/TXN) Rabbit mAb (A4024) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Thioredoxin 1 (Trx1/TXN) Rabbit mAb
Catalog No.	A4024
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2658

Background

The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 26-105 of human Thioredoxin 1 (Trx1/TXN) (P10599).
Sequence	DFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Gene ID
Swiss Prot
Synonyms	TRX; TRDX; TRX1; Trx80; Thioredoxin 1 (Trx1/TXN)
Calculated MW	12kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:2000 - 1:8000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, HepG2, MCF7, THP-1, Mouse lung, Mouse brain, Rat liver
Cellular location	Cytoplasm, Nucleus, Secreted.
Customer validation	WB(Mus musculus)