제품 > 항체 > 다중클론항체(pAb)

Thioredoxin 1 (Trx1/TXN) Rabbit pAb (A7638)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Thioredoxin 1 (Trx1/TXN) Rabbit pAb (A7638) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Thioredoxin 1 (Trx1/TXN) Rabbit pAb (A7638)

Immunohistochemistry analysis of paraffin-embedded Human colon using Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) Rabbit pAb (A7638) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Thioredoxin 1 (Trx1/TXN) Rabbit pAb (A7638)

Immunofluorescence analysis of NIH-3T3 cells using Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) Rabbit pAb (A7638) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Thioredoxin 1 (Trx1/TXN) Rabbit pAb (A7638)

Immunoprecipitation analysis of 150 μg extracts of MCF7 cells using 3 μg Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) antibody (A7638). Western blot was performed from the immunoprecipitate using Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) antibody (A7638) at a dilution of 1:500.

Overview

Product name	Thioredoxin 1 (Trx1/TXN) Rabbit pAb
Catalog No.	A7638
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 2-105 of human Trx1/Thioredoxin 1 (Trx1/TXN) (NP_003320.2).
Sequence	VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Gene ID
Swiss Prot
Synonyms	TRX; TRDX; TRX1; Trx80; Thioredoxin 1 (Trx1/TXN)
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HepG2, H460, MCF7, HT-29, SKOV3
Cellular location	Cytoplasm, Nucleus, Secreted
Customer validation	WB(Mus musculus, Homo sapiens)