제품 > 항체 > 단일클론항체(mAb)

Tropomyosin 1 Rabbit mAb (A8723)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Tropomyosin 1 Rabbit mAb (A8723) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Tropomyosin 1 Rabbit mAb (A8723)

Immunohistochemistry analysis of paraffin-embedded Rat heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Tropomyosin 1 Rabbit mAb (A8723)

Immunofluorescence analysis of paraffin-embedded rat heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse heart using Tropomyosin 1 Rabbit mAb (A8723) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Tropomyosin 1 Rabbit mAb (A8723)

Immunoprecipitation analysis of 600 μg extracts of Rat heart using 3 μg Tropomyosin 1 Rabbit mAb (A8723). Western blot was performed from the immunoprecipitate using Tropomyosin 1 Rabbit mAb (A8723) at a dilution of 1:1000.

Overview

Product name	Tropomyosin 1 Rabbit mAb
Catalog No.	A8723
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1283

Background

This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy and dilated cardiomyopathy 1Y.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493).
Sequence	LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
Gene ID
Swiss Prot
Synonyms	CMH3; TMSA; CMD1Y; LVNC9; C15orf13; HEL-S-265; HTM-alpha; Tropomyosin 1
Calculated MW	33kDa
Observed MW	32、35、36、41kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
Cellular location	Cytoplasm, cytoskeleton