제품 > 항체 > 단일클론항체(mAb)

γ-Tubulin Rabbit mAb (A9657)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using γ-Tubulin Rabbit mAb (A9657) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - γ-Tubulin Rabbit mAb (A9657)

Immunohistochemistry analysis of paraffin-embedded Rat testis using γ-Tubulin Rabbit mAb (A9657) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using γ-Tubulin Rabbit mAb (A9657) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using γ-Tubulin Rabbit mAb (A9657) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - γ-Tubulin Rabbit mAb (A9657)

Confocal imaging of NIH-3T3 cells using γ-Tubulin Rabbit mAb (A9657, dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Confocal imaging of U-2OS cells using γ-Tubulin Rabbit mAb (A9657, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	γ-Tubulin Rabbit mAb
Catalog No.	A9657
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1684

Background

This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 231-451 of human γ-Tubulin (P23258).
Sequence	LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Gene ID
Swiss Prot
Synonyms	TUBG; GCP-1; CDCBM4; TUBGCP1; γ-Tubulin
Calculated MW	51kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-2 OS, MCF7, Jurkat, NIH/3T3, Mouse brain, Rat testis, Rat brain
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center.
Customer validation	IF(Homo sapiens)