제품 > 항체 > 다중클론항체(pAb)

Tulp2 Rabbit pAb (A18256)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat testis, using Tulp2 Rabbit pAb (A18256) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates using Tulp2 Rabbit pAb (A18256) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Tulp2 Rabbit pAb (A18256)

Immunohistochemistry analysis of paraffin-embedded rat testis using Tulp2 Rabbit pAb (A18256) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse testis using Tulp2 Rabbit pAb (A18256) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Tulp2 Rabbit pAb
Catalog No.	A18256
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable phosphoric diester hydrolase activity. Predicted to be involved in protein localization to cilium. Predicted to be located in cytoplasm and extracellular region. Predicted to be active in cilium. Is expressed in urogenital ridge. Orthologous to human TULP2 (TUB like protein 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 78-305 of mouse Tulp2 (NP_032833.2).
Sequence	FQSDSSWGLGVGSPFLQENVPQAHLPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQPRIPGPRLG
Gene ID
Swiss Prot
Synonyms	Pdet; Tulp2
Calculated MW	63kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	NIH/3T3, PC-3, SKOV3, Rat testis
Cellular location	cilium, cytoplasm, extracellular region