UGT2B17 Rabbit pAb (A20683)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - UGT2B17 Rabbit pAb (A20683)

Immunofluorescence analysis of HepG2 cells using UGT2B17 Rabbit pAb (A20683) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-3 cells using UGT2B17 Rabbit pAb (A20683) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	UGT2B17 Rabbit pAb
Catalog No.	A20683
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene encodes a member of the uridine diphosphoglucuronosyltransferase protein family. The encoded enzyme catalyzes the transfer of glucuronic acid from uridine diphosphoglucuronic acid to a diverse array of substrates including steroid hormones and lipid-soluble drugs. This process, known as glucuronidation, is an intermediate step in the metabolism of steroids. Copy number variation in this gene is associated with susceptibility to osteoporosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human UGT2B17 (NP_001068.1).
Sequence	GHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMS
Gene ID
Swiss Prot
Synonyms	BMND12; UDPGT2B17
Calculated MW	61kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location