제품 > 항체 > 단일클론항체(mAb)

VCAM1 Rabbit mAb (A19131)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat lung, using VCAM1 Rabbit mAb (A19131) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - VCAM1 Rabbit mAb (A19131)

Confocal imaging of human kidney using VCAM1 Rabbit mAb (A19131, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Overview

Product name	VCAM1 Rabbit mAb
Catalog No.	A19131
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0312

Background

This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 640-739 of human VCAM1 (P19320).
Sequence	ETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV
Gene ID
Swiss Prot
Synonyms	CD106; INCAM-100; VCAM1
Calculated MW	81kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat lung
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Rattus norvegicus, Homo sapiens, Mus musculus) IF(Mus musculus, Oryctolagus cuniculus)