제품 > 항체 > 단일클론항체(mAb)

VDAC 1/2/3 Rabbit PolymAb® (A27273PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at 1:9000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - VDAC 1/2/3 Rabbit PolymAb® (A27273PM)

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - VDAC 1/2/3 Rabbit PolymAb® (A27273PM)

Confocal imaging of paraffin-embedded Rat testis tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse testis tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Human tonsil tissue using VDAC 1/2/3 Rabbit PolymAb® (A27273PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	VDAC 1/2/3 Rabbit PolymAb®
Catalog No.	A27273PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC 1/2/3 (NP_003366.2).
Sequence	MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIED
Gene ID
Swiss Prot
Synonyms	PORIN; VDAC-1
Calculated MW	31kDa
Observed MW	31kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:9000 - 1:54000 IHC-P 1:400 - 1:1600 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, Mouse testis
Cellular location	Cell membrane, Membrane raft, Mitochondrion outer membrane, Multi-pass membrane protein.