제품 > 항체 > 단일클론항체(mAb)

VDAC2 Rabbit mAb (A21260)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using VDAC2 Rabbit mAb (A21260) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - VDAC2 Rabbit mAb (A21260)

Immunohistochemistry analysis of VDAC2 in paraffin-embedded mouse kidney tissue using VDAC2 Rabbit mAb (A21260) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of VDAC2 in paraffin-embedded human liver cancer tissue using VDAC2 Rabbit mAb (A21260) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of VDAC2 in paraffin-embedded human liver tissue using VDAC2 Rabbit mAb (A21260) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of VDAC2 in paraffin-embedded rat testis tissue using VDAC2 Rabbit mAb (A21260) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	VDAC2 Rabbit mAb
Catalog No.	A21260
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53370

Background

This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDAC2 (NP_003366.2).
Sequence	MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIED
Gene ID
Swiss Prot
Synonyms	POR; VDAC2
Calculated MW	32kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, HeLa, Mouse brain, Mouse testis, Rat brain
Cellular location	Mitochondrion outer membrane
Customer validation	WB(Homo sapiens)