Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | VEGFA Mouse mAb |
---|---|
Catalog No. | A17877 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG1, kappa |
CloneNo. | AMC0005 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 207-327 of human VEGFA (P15692). |
---|---|
Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR |
Gene ID | |
Swiss Prot | |
Synonyms | VPF; VEGF; MVCD1; VEGFA |
Calculated MW | 27kDa |
Observed MW | 20kDa/23kDa/26kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung, Mouse heart, Rat lung |
Cellular location | Secreted. |
Customer validation | WB(Homo sapiens, Mus musculus, Mus musculus) IHC(Homo sapiens, Mus musculus) IHC(Rattus norvegicus, Homo sapiens, IHC, ELISA, Mus musculus) ELISA(Rattus norvegicus) ELISA(IHC, ELISA) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17877? Please let us know so that we can cite the reference in this datasheet.