Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | VEGF Rabbit mAb |
---|---|
Catalog No. | A23759 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC61370 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 38-135 of human VEGF(NP_001165094.1). |
---|---|
Sequence | HEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD |
Gene ID | |
Swiss Prot | |
Synonyms | VEGFA; MVCD1; VEGF; VPF; vascular endothelial growth factor A |
Calculated MW | 15-27kDa/34-45kDa |
Observed MW | 16kDa/35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Recombinant Human VEGF-A/VEGF121(K321N) Protein |
Cellular location | Secreted. |
Customer validation | IF(Mus musculus) WB(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23759? Please let us know so that we can cite the reference in this datasheet.