Review (1)Publications (23) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | VEGFA Rabbit pAb |
---|---|
Catalog No. | A0280 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human VEGFA (NP_001165094.1). |
---|---|
Sequence | SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQ |
Gene ID | |
Swiss Prot | |
Synonyms | VPF; VEGF; MVCD1; VEGFA |
Calculated MW | 27kDa |
Observed MW | 39kDa/43kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | U-87MG, K-562, Mouse heart, Rat heart |
Cellular location | Secreted. |
Customer validation | (SH-SY5Y) WB(Mus musculus, Oryctolagus cuniculus, Homo sapiens, Rattus norvegicus) IHC(Homo sapiens, Rattus norvegicus, Mus musculus) IF(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens) IHC(Rattus norvegicus) IHC(Rattus norvegicus) WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0280? Please let us know so that we can cite the reference in this datasheet.