Review (1)Publications (29) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | XBP1 Rabbit pAb |
---|---|
Catalog No. | A1731 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 277-376 of human XBP1 (NP_005071.2). |
---|---|
Sequence | NVVVKIEEAPLSPSENDHPEFIVSVKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCGYGGSLSPFSDMSSLLGVNHSWEDTFANELFPQLISV |
Gene ID | |
Swiss Prot | |
Synonyms | XBP2; TREB5; XBP-1; TREB-5; XBP1 |
Calculated MW | 29kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse spleen |
Cellular location | Cytoplasm, Endoplasmic reticulum membrane, Endoplasmic reticulum, Membrane, Nucleus, Peripheral membrane protein, Single-pass type II membrane protein. |
Customer validation | (RAW264.7) WB(Mus musculus, Rattus norvegicus, Homo sapiens, Bos taurus, Gallus gallus, Sus scrofa, Anatinae, Canis lupus familiaris) IHC(Rattus norvegicus) IF(Rattus norvegicus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1731? Please let us know so that we can cite the reference in this datasheet.